UniProt ID | NANOS_DROME | |
---|---|---|
UniProt AC | P25724 | |
Protein Name | Protein nanos | |
Gene Name | nos | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 401 | |
Subcellular Localization | ||
Protein Description | Maternal RNA-binding protein that is required for germ cells proliferation and self-renewal. Acts by forming a complex with pum and brat that regulates translation and mRNA stability. The complex binds to the Nanos Response Element (NRE), a 16 bp sequence in the hb mRNA 3'-UTR and prevents its translation. Controls posterior development. Rescuing factor for the abdominal defect of posterior group mutants. The other posterior group genes are not required for nanos function but rather play a role in localization or distribution of nanos protein.. | |
Protein Sequence | MFRSNLEGSGAAAVGVANPPSLAQSGKIFQLQDNFSAFHARGGLNILGLQDMYLDTSGANSSATLSPPITPVTPDPSTSAQSTHFPFLADSAATANSLLMQRQYHYHLLLQQQQQLAMAQHQLALAASAAAASASHQQTDEIARSLKIFAQVTTGAAENAAGSMQDVMQEFATNGYASDDLGRMSYGSAPPQVQMPPQQQHQQQQGLHLPLGRNPAQLQTNGGNLMPIPLATHWLNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAESFRLAKSSYYKQQMKV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of NANOS_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NANOS_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NANOS_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NANOS_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...