| UniProt ID | HUNB_DROME | |
|---|---|---|
| UniProt AC | P05084 | |
| Protein Name | Protein hunchback | |
| Gene Name | hb | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 758 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Gap class segmentation protein that controls development of head structures.. | |
| Protein Sequence | MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIPSTNHLEQFLKQQQQQLQQQPMDTLCAMTPSPSQNDQNSLQHYDANLQQQLLQQQQYQQHFQAAQQQHHHHHHLMGGFNPLTPPGLPNPMQHFYGGNLRPSPQPTPTSASTIAPVAVATGSSEKLQALTPPMDVTPPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGPKSKNGGPIASGGSGSGSRKSNVAAVAPQQQQSQPAQPVATSQLSAALQGFPLVQGNSAPPAASPVLPLPASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNLNLQMLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQDDEYERKSVDSAMDLSQGTPVKEDEQQQQPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVPSTPMPTASSPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNASSNSNGNSSSNSSSNGTTSAVAAPPSGTPAAAGAIYECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLFVHMARNAHS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 178 | Phosphorylation | SEKLQALTPPMDVTP HHHHHHCCCCCCCCC | 28.50 | 22817900 | |
| 188 | Phosphorylation | MDVTPPKSPAKSSQS CCCCCCCCCCCCCCC | 35.54 | 22817900 | |
| 207 | Phosphorylation | EKEHDQMSNSSEDMK HHHHHHCCCCHHHHH | 28.11 | 22817900 | |
| 209 | Phosphorylation | EHDQMSNSSEDMKYM HHHHCCCCHHHHHHH | 28.00 | 22817900 | |
| 210 | Phosphorylation | HDQMSNSSEDMKYMA HHHCCCCHHHHHHHH | 41.70 | 22817900 | |
| 219 | Phosphorylation | DMKYMAESEDDDTNI HHHHHHHCCCCCCCC | 36.47 | 22817900 | |
| 537 | Phosphorylation | DDEYERKSVDSAMDL HHHHHHHHHHHHHHH | 37.06 | 22817900 | |
| 540 | Phosphorylation | YERKSVDSAMDLSQG HHHHHHHHHHHHHCC | 24.28 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HUNB_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HUNB_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HUNB_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LAM0_DROME | Lam | genetic | 23332748 | |
| PDM2A_DROME | pdm2 | genetic | 20335359 | |
| PDM2B_DROME | pdm2 | genetic | 20335359 | |
| KRUP_DROME | Kr | genetic | 11518507 | |
| BCD_DROME | bcd | genetic | 10725234 | |
| FTZ_DROME | ftz | genetic | 3100363 | |
| NANOS_DROME | nos | genetic | 15817222 | |
| DAN_DROME | dan | genetic | 23332748 | |
| CAS_DROME | cas | genetic | 20335359 | |
| ADF1_DROME | Adf1 | physical | 23935523 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-178; SER-188; SER-207;SER-209; SER-210; SER-537 AND SER-540, AND MASS SPECTROMETRY. | |
