UniProt ID | HUNB_DROME | |
---|---|---|
UniProt AC | P05084 | |
Protein Name | Protein hunchback | |
Gene Name | hb | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 758 | |
Subcellular Localization | Nucleus. | |
Protein Description | Gap class segmentation protein that controls development of head structures.. | |
Protein Sequence | MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIPSTNHLEQFLKQQQQQLQQQPMDTLCAMTPSPSQNDQNSLQHYDANLQQQLLQQQQYQQHFQAAQQQHHHHHHLMGGFNPLTPPGLPNPMQHFYGGNLRPSPQPTPTSASTIAPVAVATGSSEKLQALTPPMDVTPPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGPKSKNGGPIASGGSGSGSRKSNVAAVAPQQQQSQPAQPVATSQLSAALQGFPLVQGNSAPPAASPVLPLPASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNLNLQMLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQDDEYERKSVDSAMDLSQGTPVKEDEQQQQPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVPSTPMPTASSPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNASSNSNGNSSSNSSSNGTTSAVAAPPSGTPAAAGAIYECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLFVHMARNAHS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
178 | Phosphorylation | SEKLQALTPPMDVTP HHHHHHCCCCCCCCC | 28.50 | 22817900 | |
188 | Phosphorylation | MDVTPPKSPAKSSQS CCCCCCCCCCCCCCC | 35.54 | 22817900 | |
207 | Phosphorylation | EKEHDQMSNSSEDMK HHHHHHCCCCHHHHH | 28.11 | 22817900 | |
209 | Phosphorylation | EHDQMSNSSEDMKYM HHHHCCCCHHHHHHH | 28.00 | 22817900 | |
210 | Phosphorylation | HDQMSNSSEDMKYMA HHHCCCCHHHHHHHH | 41.70 | 22817900 | |
219 | Phosphorylation | DMKYMAESEDDDTNI HHHHHHHCCCCCCCC | 36.47 | 22817900 | |
537 | Phosphorylation | DDEYERKSVDSAMDL HHHHHHHHHHHHHHH | 37.06 | 22817900 | |
540 | Phosphorylation | YERKSVDSAMDLSQG HHHHHHHHHHHHHCC | 24.28 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HUNB_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HUNB_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HUNB_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LAM0_DROME | Lam | genetic | 23332748 | |
PDM2A_DROME | pdm2 | genetic | 20335359 | |
PDM2B_DROME | pdm2 | genetic | 20335359 | |
KRUP_DROME | Kr | genetic | 11518507 | |
BCD_DROME | bcd | genetic | 10725234 | |
FTZ_DROME | ftz | genetic | 3100363 | |
NANOS_DROME | nos | genetic | 15817222 | |
DAN_DROME | dan | genetic | 23332748 | |
CAS_DROME | cas | genetic | 20335359 | |
ADF1_DROME | Adf1 | physical | 23935523 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-178; SER-188; SER-207;SER-209; SER-210; SER-537 AND SER-540, AND MASS SPECTROMETRY. |