| UniProt ID | BCD_DROME | |
|---|---|---|
| UniProt AC | P09081 | |
| Protein Name | Homeotic protein bicoid | |
| Gene Name | bcd | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 494 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Segment polarity protein that provides positional cues for the development of head and thoracic segments. Regulates the expression of zygotic genes, possibly through its homeodomain, and inhibits the activity of other maternal gene products. May also bind RNA. Interacts with Bin1 to repress transcription of bicoid target genes in the anterior tip of the embryo; a process known as retraction.. | |
| Protein Sequence | MAQPPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAIAVGETEAADDMDDGTSKKTTLQILEPLKGLDKSCDDGSSDDMSTGIRALAGTGNRGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYNPHRNAAGNSQFAYCFN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 411 | Phosphorylation | PLKGLDKSCDDGSSD HCCCCCCCCCCCCCC | 23.57 | 22817900 | |
| 416 | Phosphorylation | DKSCDDGSSDDMSTG CCCCCCCCCCCHHHH | 37.27 | 22817900 | |
| 417 | Phosphorylation | KSCDDGSSDDMSTGI CCCCCCCCCCHHHHH | 43.06 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BCD_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BCD_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BCD_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SERC_DROME | CG11899 | physical | 14605208 | |
| RS10B_DROME | RpS10b | physical | 14605208 | |
| MS84D_DROME | Mst84Dd | physical | 14605208 | |
| RS15A_DROME | RpS15Aa | physical | 14605208 | |
| DFD_DROME | Dfd | physical | 14605208 | |
| UZIP_DROME | uzip | physical | 14605208 | |
| TTKB_DROME | ttk | physical | 9267026 | |
| TTKA_DROME | ttk | physical | 9267026 | |
| SAP18_DROME | Bin1 | physical | 11455422 | |
| RS27A_DROME | RpS27A | physical | 21170036 | |
| TORSO_DROME | tor | genetic | 16280349 | |
| HID_DROME | W | genetic | 16280349 | |
| HUNB_DROME | hb | genetic | 7607091 | |
| HUNB_DROME | hb | genetic | 10741965 | |
| CAD_DROME | cad | physical | 8602214 | |
| CAD_DROME | cad | physical | 8602224 | |
| BN3D1_DROME | bin3 | physical | 10717484 | |
| SAP18_DROME | Bin1 | physical | 10717484 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
