SAP18_DROME - dbPTM
SAP18_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID SAP18_DROME
UniProt AC Q9VEX9
Protein Name Histone deacetylase complex subunit SAP18
Gene Name Bin1
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 150
Subcellular Localization Nucleus . Cytoplasm . Shuttles between the nucleus and the cytoplasm.
Protein Description Involved in the tethering of the SIN3 complex to core histone proteins. Interacts with bicoid (bcd) to repress transcription of bicoid target genes in the anterior tip of the embryo; a process known as retraction. Interacts with Trl and binds to Polycomb response elements at the bithorax complex. May contribute to the regulation of other homeotic gene expressions..
Protein Sequence MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of SAP18_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of SAP18_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of SAP18_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of SAP18_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
BCD_DROMEbcdphysical
11455422

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of SAP18_DROME

loading...

Related Literatures of Post-Translational Modification

TOP