SAP18_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAP18_DROME
• UniProt AC: Q9VEX9
• Protein Name: Histone deacetylase complex subunit SAP18
• Gene Name: Bin1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 150
• Subcellular Localization: Nucleus . Cytoplasm . Shuttles between the nucleus and the cytoplasm.
• Protein Description: Involved in the tethering of the SIN3 complex to core histone proteins. Interacts with bicoid (bcd) to repress transcription of bicoid target genes in the anterior tip of the embryo; a process known as retraction. Interacts with Trl and binds to Polycomb response elements at the bithorax complex. May contribute to the regulation of other homeotic gene expressions..
• Protein Sequence: MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SAP18_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAP18_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAP18_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAP18_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BCD_DROME	bcd	physical	11455422

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.