UniProt ID | SERC_DROME | |
---|---|---|
UniProt AC | Q9VAN0 | |
Protein Name | Probable phosphoserine aminotransferase | |
Gene Name | CG11899 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 364 | |
Subcellular Localization | ||
Protein Description | Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.. | |
Protein Sequence | MVINFAAGPAKLPEEVLKEVQENLVNCNGSGISVMEMSHRSSNYAKIHDATISDLRELLNVPSNYKILLMQGGGTGQFAAVALNLIGKTGTADYVITGSWSAKAAKEAAQYGTVNAVLPKLAKYTTVPRQETWKLDPNASYVYYCDNETVEGVEFDFVPEVPAGVPLVADMSSNFLSRPFDVSKFGVIYAGAQKNIGPAGTTVIIVRDDLIGKHLKITPSILNFEQMDKNNSLLNTPPTFGIYVMGLVFKWIKRNGGVAGMAKLAAAKSKLIYDTINQSNGFYYCPVDVNVRSRMNVPFRIGSASGDDALEKEFLSKAEAEGMIQLKGHRSVGGIRASLYNAVTLAETQQLANLMLAFYKNNKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | NLVNCNGSGISVMEM HHCCCCCCCEEEEEE | 20.97 | 22817900 | |
42 | Phosphorylation | MEMSHRSSNYAKIHD EEECCCCCCCCEEEE | 33.54 | 22817900 | |
44 | Phosphorylation | MSHRSSNYAKIHDAT ECCCCCCCCEEEECC | 15.95 | 22817900 | |
46 | Ubiquitination | HRSSNYAKIHDATIS CCCCCCCEEEECCHH | 30.16 | 31113955 | |
194 | N6-(pyridoxal phosphate)lysine | VIYAGAQKNIGPAGT EEEEECCCCCCCCCC | 50.42 | - | |
194 | Other | VIYAGAQKNIGPAGT EEEEECCCCCCCCCC | 50.42 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SERC_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SERC_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SERC_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MSRB_DROME | SelR | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...