dbPTM

MSRB_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MSRB_DROME
UniProt AC	Q8INK9
Protein Name	Methionine-R-sulfoxide reductase B1
Gene Name	SelR
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	208
Subcellular Localization	Cytoplasm . Nucleus . Cytoplasm, cytoskeleton .
Protein Description	Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residues. Acts as a regulator of actin assembly by reducing methionine (R)-sulfoxide mediated by Mical on actin thereby promoting filament repolymerization..
Protein Sequence	MFALSARHALRRTRIFAIPRFFADSRQDSDNPDKRYSGPAATMDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPGGNILLLIAHPERIRTEVRCARCNAHMGHVFEDGPKPTRKRYCINSASIEFVNADPATSSPPVATPTAAPIAQQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	EELRKRLTPVQYQVT HHHHHHCCCCEEEEC	26.00	21082442
74	Phosphorylation	QVTQEAGTERPFTGC EECCCCCCCCCCCCC	35.55	21082442
132	Phosphorylation	VTLHRDASIPGGNIL EEEEECCCCCCCCEE	33.34	19429919
176	Phosphorylation	PKPTRKRYCINSASI CCCCCCEEEECCCEE	10.75	22817900
180	Phosphorylation	RKRYCINSASIEFVN CCEEEECCCEEEEEC	11.95	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MSRB_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MSRB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MSRB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MSRB_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MSRB_DROME

Related Literatures of Post-Translational Modification