dbPTM

KRUP_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KRUP_DROME
UniProt AC	P07247
Protein Name	Protein krueppel
Gene Name	Kr
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	502
Subcellular Localization	Nucleus . Chromatin associated.
Protein Description	Krueppel is a gap class segmentation protein. It is involved in the segmentation of the embryo and in the differentiation of the Malpighian tubules..
Protein Sequence	MSISMLQDAQTRTLAAALAGIKQEDVHLDRSMSLSPPMSANTSATSAAAIYPAMGLQQAAAASAFGMLSPTQLLAANRQAAAFMAQLPMSTLANTLFPHNPAALFGAWAAQQSLPPQGTHLHSPPASPHSPLSTPLGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEISMSVNDMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNHKCGIQSPPTPALSPAMSGDYPVAISAIAIEASTNRFAAMCATYGGSNESVDMEKATPEDDGPLDLSEDGASSVDGHCSNIARRKAQDIRRVFRLPPPQIPHVPSDMPEQTEPEDLSMHSPRSIGSHEQTDDIDLYDLDDAPASYMGHQQH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
468	Phosphorylation	QTEPEDLSMHSPRSI CCCCCCCCCCCCCCC	27.11	18327897
471	Phosphorylation	PEDLSMHSPRSIGSH CCCCCCCCCCCCCCC	17.23	18327897
477	Phosphorylation	HSPRSIGSHEQTDDI CCCCCCCCCCCCCCC	23.37	18327897

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KRUP_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KRUP_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KRUP_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTBP_DROME	CtBP	physical	14605208
SAP18_DROME	Bin1	physical	19049982
CTBP_DROME	CtBP	physical	19049982
EXPA_DROME	ex	genetic	11007492
STAR_DROME	S	genetic	11007492
DECA_DROME	dpp	genetic	11007492
KRH1_DROME	Kr-h1	genetic	11007492
PIWI_DROME	piwi	genetic	21186352
RAB6_DROME	Rab6	genetic	11007492
BUN1_DROME	bun	genetic	11007492
BUN2_DROME	bun	genetic	11007492
SEM2A_DROME	Sema-2a	genetic	11007492
GSTS1_DROME	GstS1	genetic	11007492
EMC_DROME	emc	genetic	9724781
EMC_DROME	emc	genetic	11007492
SPY_DROME	sty	genetic	11007492
E75BB_DROME	Eip75B	genetic	9724781
E75BC_DROME	Eip75B	genetic	9724781
E75BA_DROME	Eip75B	genetic	9724781
E75BB_DROME	Eip75B	genetic	11007492
E75BC_DROME	Eip75B	genetic	11007492
E75BA_DROME	Eip75B	genetic	11007492
RUVB2_DROME	rept	genetic	9724781
CHDM_DROME	Mi-2	genetic	9724781
CHDM_DROME	Mi-2	genetic	11007492
PKRA_DROME	kra	genetic	9724781
VATB_DROME	Vha55	genetic	9724781
VATB_DROME	Vha55	genetic	11007492
SRP_DROME	srp	genetic	22252491
OSA_DROME	osa	genetic	9724781
OSA_DROME	osa	genetic	11007492
OVO_DROME	ovo	physical	23847101

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KRUP_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-468; SER-471 ANDSER-477, AND MASS SPECTROMETRY.	18327897 [Abstract]