dbPTM

EMC_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EMC_DROME
UniProt AC	P18491
Protein Name	Protein extra-macrochaetae
Gene Name	emc
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	199
Subcellular Localization	Nucleus.
Protein Description	Participates in sensory organ patterning by antagonizing the neurogenic activity of the Achaete-scute complex (AS-C). It lacks a basic DNA-binding domain but is able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. May sequester proneural proteins in complexes inefficient for DNA interaction. EMC also affects vein differentiation. Inhibits the activity of AS-C proteins by forming an non-DNA binding heterodimer..
Protein Sequence	MKSLTAVCQTGASGMPALNASGRIQRHPTHRGDGENAEMKMYLSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGNFDAAAALTAVNGLHEDEDSDMEDADAEAEAEVDPDILAQRLNAEQPAKVSSPAARLPLTDRQTPNTLVAPAHPQQHQQQQQLQLQQQQLQSQQQLSNSLATPQNAEKDSRQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
106	Phosphorylation	GLHEDEDSDMEDADA CCCCCCCCCHHHHHH	36.49	-
138	Phosphorylation	EQPAKVSSPAARLPL CCCCCCCCCCCCCCC	22.88	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EMC_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EMC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EMC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AST4_DROME	sc	physical	14605208
DA_DROME	da	physical	14605208
AST4_DROME	sc	genetic	14704182
NOTCH_DROME	N	genetic	10804180
DA_DROME	da	genetic	22078884
SRF_DROME	bs	genetic	9550715
RS17_DROME	RpS17	genetic	22078884
DL_DROME	Dl	genetic	10804180
HLES_DROME	H	genetic	10835395
AST5_DROME	ac	physical	25977368
AST5_DROME	ac	physical	9371806
AST4_DROME	sc	physical	9371806
AST4_DROME	sc	physical	9524128
DA_DROME	da	physical	25977368
DA_DROME	da	physical	9371806
DA_DROME	da	physical	9486535

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EMC_DROME

Related Literatures of Post-Translational Modification