UniProt ID | RS17_DROME | |
---|---|---|
UniProt AC | P17704 | |
Protein Name | 40S ribosomal protein S17 | |
Gene Name | RpS17 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 131 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQVRGISIKLQEEERERRDNYVPAVSALEQDIIEVDADTKEMLKLLDFHNIRGLQLTQPNTNNFGRRN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Acetylation | AAKVIIEKYYTRLTL HHHHHHHHHHHHHEE | 32.90 | 21791702 | |
49 | Ubiquitination | PTKPLRNKIAGYVTH CCCCCCHHHHHHHHH | 27.74 | 31113955 | |
124 | Phosphorylation | LQLTQPNTNNFGRRN EECCCCCCCCCCCCC | 37.92 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS17_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS17_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS17_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FTZF1_DROME | ftz-f1 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...