BUN1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BUN1_DROME
• UniProt AC: Q24522
• Protein Name: Protein bunched, class 1/class 3/D/E isoforms
• Gene Name: bun
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 219
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis. May be required for the transmission of the dpp signal and for a morphogenetic movement of the medulla in the brain that reorients the second optic lobe relative to the first. Plays a role in determining proper dorsal cell fates leading to the formation of the dorsal appendages..
• Protein Sequence: MKTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of BUN1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BUN1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BUN1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BUN1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STAR_DROME	S	genetic	7555710
POK_DROME	aop	genetic	7555710
HH_DROME	hh	genetic	7555710

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.