UniProt ID | RAB6_DROME | |
---|---|---|
UniProt AC | O18334 | |
Protein Name | Ras-related protein Rab6 {ECO:0000312|EMBL:AAF53168.1} | |
Gene Name | Rab6 {ECO:0000312|EMBL:AAF53168.1, ECO:0000312|FlyBase:FBgn0015797} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 208 | |
Subcellular Localization | Golgi apparatus membrane . Cell junction, synapse . Perikaryon . Colocalizes with Rich at the Golgi apparatus. During oogenesis, first accumulates transiently in a central position during stages 7-8, then is uniformly distributed at the beginning of | |
Protein Description | Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Mediates membrane trafficking during egg chamber growth and organization, possibly upstream of exocyst component Sec5. Also during oogenesis, plays a role, together with BicD but independently of Sec5, in the polarization of the oocyte microtubule cytoskeleton, in the localization of oskar mRNA and in the anterodorsal secretion of grk. Required for anterograde opsin transport through the ER-Golgi complex. Plays a role, together with Rich, in regulating CadN transport in photoreceptor cells which is required for the formation of normal synaptic connections between axons from the inner photoreceptor cells in the eye and postsynaptic cells in the brain medulla layer M6. Necessary for proper development of bristle shafts of macrochaete and microchaete on the head, thorax and scutellum. Modulates Notch signaling. As a key regulator of vesicular traffic, plays a critical role in the regulation of actin organization and is required for normal rates of phagocytic uptake during phagocytosis involved in defense against viral and fungal infection.. | |
Protein Sequence | MSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNETKDPEGGCAC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RS8_DROME | RpS8 | physical | 14605208 | |
BICD_DROME | BicD | physical | 15710747 | |
BSG2_DROME | Bsg25D | physical | 15710747 | |
EVI5_DROME | Evi5 | physical | 15710747 | |
MYSN_DROME | zip | physical | 15710747 | |
3BP5H_DROME | pcs | physical | 15710747 | |
RS3A_DROME | RpS3A | physical | 15710747 | |
PP4R3_DROME | flfl | physical | 15710747 | |
JIL1_DROME | JIL-1 | physical | 15710747 | |
TTKB_DROME | ttk | physical | 15710747 | |
TTKA_DROME | ttk | physical | 15710747 | |
ACADM_DROME | CG12262 | physical | 22036573 | |
ERD2_DROME | KdelR | physical | 22036573 | |
CIN_DROME | cin | physical | 25453831 | |
VPS26_DROME | Vps26 | physical | 25453831 | |
EVI5_DROME | Evi5 | physical | 25453831 | |
BICD_DROME | BicD | physical | 25453831 | |
BICD_DROME | BicD | physical | 17329360 | |
BICD_DROME | BicD | physical | 17827179 | |
BICD_DROME | BicD | physical | 23723415 | |
BRUN_DROME | bru | physical | 25453831 | |
MYSN_DROME | zip | physical | 25453831 | |
CDC37_DROME | Cdc37 | physical | 25453831 | |
RINT1_DROME | Rint1 | physical | 25453831 | |
RIC1_DROME | Rich | physical | 21835342 | |
TPC10_DROME | SIDL | physical | 25453831 | |
FAF_DROME | faf | physical | 25453831 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...