RAB6_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB6_DROME
• UniProt AC: O18334
• Protein Name: Ras-related protein Rab6 {ECO:0000312|EMBL:AAF53168.1}
• Gene Name: Rab6 {ECO:0000312|EMBL:AAF53168.1, ECO:0000312|FlyBase:FBgn0015797}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 208
• Subcellular Localization: Golgi apparatus membrane . Cell junction, synapse . Perikaryon . Colocalizes with Rich at the Golgi apparatus. During oogenesis, first accumulates transiently in a central position during stages 7-8, then is uniformly distributed at the beginning of
• Protein Description: Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Mediates membrane trafficking during egg chamber growth and organization, possibly upstream of exocyst component Sec5. Also during oogenesis, plays a role, together with BicD but independently of Sec5, in the polarization of the oocyte microtubule cytoskeleton, in the localization of oskar mRNA and in the anterodorsal secretion of grk. Required for anterograde opsin transport through the ER-Golgi complex. Plays a role, together with Rich, in regulating CadN transport in photoreceptor cells which is required for the formation of normal synaptic connections between axons from the inner photoreceptor cells in the eye and postsynaptic cells in the brain medulla layer M6. Necessary for proper development of bristle shafts of macrochaete and microchaete on the head, thorax and scutellum. Modulates Notch signaling. As a key regulator of vesicular traffic, plays a critical role in the regulation of actin organization and is required for normal rates of phagocytic uptake during phagocytosis involved in defense against viral and fungal infection..
• Protein Sequence: MSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNETKDPEGGCAC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSSGDFGNP ------CCCCCCCCC		27794539
3	Phosphorylation	-----MSSGDFGNPL -----CCCCCCCCCC		27794539
163	Acetylation	AKAGYNVKQLFRRVA HHCCCCHHHHHHHHH		21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAB6_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB6_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB6_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS8_DROME	RpS8	physical	14605208
BICD_DROME	BicD	physical	15710747
BSG2_DROME	Bsg25D	physical	15710747
EVI5_DROME	Evi5	physical	15710747
MYSN_DROME	zip	physical	15710747
3BP5H_DROME	pcs	physical	15710747
RS3A_DROME	RpS3A	physical	15710747
PP4R3_DROME	flfl	physical	15710747
JIL1_DROME	JIL-1	physical	15710747
TTKB_DROME	ttk	physical	15710747
TTKA_DROME	ttk	physical	15710747
ACADM_DROME	CG12262	physical	22036573
ERD2_DROME	KdelR	physical	22036573
CIN_DROME	cin	physical	25453831
VPS26_DROME	Vps26	physical	25453831
EVI5_DROME	Evi5	physical	25453831
BICD_DROME	BicD	physical	25453831
BICD_DROME	BicD	physical	17329360
BICD_DROME	BicD	physical	17827179
BICD_DROME	BicD	physical	23723415
BRUN_DROME	bru	physical	25453831
MYSN_DROME	zip	physical	25453831
CDC37_DROME	Cdc37	physical	25453831
RINT1_DROME	Rint1	physical	25453831
RIC1_DROME	Rich	physical	21835342
TPC10_DROME	SIDL	physical	25453831
FAF_DROME	faf	physical	25453831

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.