| UniProt ID | RS8_DROME | |
|---|---|---|
| UniProt AC | Q8MLY8 | |
| Protein Name | 40S ribosomal protein S8 | |
| Gene Name | RpS8 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 208 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MGISRDSAHKRRATGGKRKSLRKKRKFELGRPAANTKLGSGRVHKVRTRGGNTKLRALRLETGNFAWASEGVARKTRIADVVYNASNNELVRTKTLVKNSIVVIDATPFRQWYEAHYVLPLGRKRNPKHAQKEDENDVLTKKRSEKVMKKYLERQKYGKVEQALEDQFTSGRILACISSRPGQCGRSDGYILEGKELEFYLKKIKSKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Acetylation | KSLRKKRKFELGRPA HHHHHHHCCCCCCCC | 52.66 | 21791702 | |
| 95 | Phosphorylation | NELVRTKTLVKNSIV CCEEECEEEEECCEE | 35.85 | 28490779 | |
| 100 | Phosphorylation | TKTLVKNSIVVIDAT CEEEEECCEEEEECC | 15.84 | 28490779 | |
| 132 | Acetylation | RNPKHAQKEDENDVL CCHHHCCCCCCCCHH | 68.84 | 21791702 | |
| 202 | Acetylation | KELEFYLKKIKSKK- CEEEHHHHHHHCCC- | 40.86 | 21791702 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS8_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS8_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS8_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NOL9_DROME | CG8414 | physical | 14605208 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...