UniProt ID | RS3A_DROME | |
---|---|---|
UniProt AC | P55830 | |
Protein Name | 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} | |
Gene Name | RpS3A {ECO:0000255|HAMAP-Rule:MF_03122} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 268 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Essential for oogenesis; required for late follicle cell development.. | |
Protein Sequence | MAVGKNKGLSKGGKKGGKKKVVDPFSRKDWYDVKAPNMFQTRQIGKTLVNRTQGQRIASDYLKGRVFEVSLADLQKDIDPERSFRKFRLIAEDVQDRNVLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCYAQQSQVRKIRARMTDIITNEVSGADLKQLVNKLALDSIAKDIEKSCQRIYPLHDVYIRKVKVLKKPRFDVSKLLELHGDGGGKSVEAVVSSEGAVIDRPEGYEPPVQEAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Ubiquitination | RKDWYDVKAPNMFQT CCCCCCCCCCCCCCC | 56.05 | 31113955 | |
41 | Phosphorylation | KAPNMFQTRQIGKTL CCCCCCCCCCCCCHH | 17.18 | 21082442 | |
46 | Acetylation | FQTRQIGKTLVNRTQ CCCCCCCCHHHHHCC | 40.07 | 21791702 | |
46 | Acetylation | FQTRQIGKTLVNRTQ CCCCCCCCHHHHHCC | 40.07 | - | |
59 | Phosphorylation | TQGQRIASDYLKGRV CCCHHHHHHHHCCCE | 25.15 | 27626673 | |
63 | Acetylation | RIASDYLKGRVFEVS HHHHHHHCCCEEEEE | 38.14 | 21791702 | |
63 | Acetylation | RIASDYLKGRVFEVS HHHHHHHCCCEEEEE | 38.14 | - | |
70 | Phosphorylation | KGRVFEVSLADLQKD CCCEEEEEHHHHHCC | 15.61 | 21082442 | |
83 | Phosphorylation | KDIDPERSFRKFRLI CCCCHHHCHHHEEEE | 27.95 | 27626673 | |
112 | Acetylation | GMDLTTDKYRSMVKK CCCCCHHHHHHHHHH | 40.23 | 21791702 | |
112 | Acetylation | GMDLTTDKYRSMVKK CCCCCHHHHHHHHHH | 40.23 | - | |
198 | Acetylation | LALDSIAKDIEKSCQ HHHHHHHHHHHHHHH | 58.53 | 21791702 | |
198 | Acetylation | LALDSIAKDIEKSCQ HHHHHHHHHHHHHHH | 58.53 | - | |
229 | Phosphorylation | KKPRFDVSKLLELHG CCCCCCHHHHHHHCC | 21.30 | 22817900 | |
242 | Phosphorylation | HGDGGGKSVEAVVSS CCCCCCCEEEEEEEC | 28.59 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS3A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS3A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS3A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPB11_DROME | Rpb11 | physical | 14605208 | |
LST8_DROME | Lst8 | physical | 14605208 | |
DCR1_DROME | Dcr-1 | physical | 14605208 | |
ATRIP_DROME | mus304 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...