128UP_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 128UP_DROME
• UniProt AC: P32234
• Protein Name: GTP-binding protein 128up
• Gene Name: 128up
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 368
• Protein Description: Deformed (Dfd) is required to activate 1.28up in maxillary segment cells..
• Protein Sequence: MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGGGTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLDCLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSELDTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKIDQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKGQLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKVGIEHVLNDEDVVQIVKKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	KLRRELISPKGGGGG HHHHHHHCCCCCCCC	32.93	25749252
295	Phosphorylation	YLRLQRIYTKPKGQL HHHHHHHCCCCCCCC	15.76	22817900
307	Phosphorylation	GQLPDYNSPVVLHNE CCCCCCCCCEEEECC	16.91	30478224

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of 128UP_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 128UP_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 128UP_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of 128UP_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.