UniProt ID | DRICE_DROME | |
---|---|---|
UniProt AC | O01382 | |
Protein Name | Caspase | |
Gene Name | Drice | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 339 | |
Subcellular Localization | ||
Protein Description | Involved in the activation cascade of caspases responsible for apoptosis execution. Acts downstream of rpr. Cleaves baculovirus p35 and lamin DmO in vitro.. | |
Protein Sequence | MDATNNGESADQVGIRVGNPEQPNDHTDALGSVGSGGAGSSGLVAGSSHPYGSGAIGQLANGYSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPAGRV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DRICE_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DRICE_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRICE_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DRONC_DROME | Nc | physical | 10675329 | |
DRICE_DROME | Ice | physical | 10675329 | |
DRICE_DROME | Ice | physical | 15710747 | |
COQ6_DROME | CG7277 | physical | 22036573 | |
PARP_DROME | Parp | physical | 21145488 | |
CASP1_DROME | Dcp-1 | genetic | 16645642 | |
CASP1_DROME | Dcp-1 | genetic | 16887831 | |
RPR_DROME | rpr | genetic | 10733594 | |
DIAP1_DROME | th | physical | 25146930 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...