UniProt ID | RB87F_DROME | |
---|---|---|
UniProt AC | P48810 | |
Protein Name | Heterogeneous nuclear ribonucleoprotein 87F | |
Gene Name | Hrb87F | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 385 | |
Subcellular Localization | Nucleus . Cytoplasm . Nuclear and/or cytoplasmic. | |
Protein Description | This protein is a component of ribonucleosomes. Could be needed to organize a concentration gradient of a dorsalizing morphogen (Dm) originating in the germinal vesicle.. | |
Protein Sequence | MAEQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGGGNRRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MAEQNDSNGNYDDG -CCCCCCCCCCCCCC | 54.94 | 19429919 | |
11 | Phosphorylation | QNDSNGNYDDGEEIT CCCCCCCCCCCCCCC | 19.46 | 27794539 | |
107 | Phosphorylation | VPRQEIDSPNAGATV CCHHHCCCCCCCCEE | 26.22 | 28490779 | |
332 | Phosphorylation | GGGPQRNSNFGNNRP CCCCCCCCCCCCCCC | 35.41 | 22817900 | |
342 | Phosphorylation | GNNRPAPYSQGGGGG CCCCCCCCCCCCCCC | 18.74 | 19429919 | |
343 | Phosphorylation | NNRPAPYSQGGGGGG CCCCCCCCCCCCCCC | 22.68 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB87F_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB87F_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB87F_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AKTP2_DROME | CG16894 | physical | 14605208 | |
DRC7_DROME | lobo | physical | 14605208 | |
ORB2_DROME | orb2 | physical | 26638074 | |
SQD_DROME | sqd | physical | 10984439 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...