| UniProt ID | DX39B_DROME | |
|---|---|---|
| UniProt AC | Q27268 | |
| Protein Name | ATP-dependent RNA helicase WM6 | |
| Gene Name | Hel25E | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 424 | |
| Subcellular Localization | Nucleus speckle . Locates to nuclei of embryos and ovaries, but disappears in mitotic domains of embryos as chromosomes condense. | |
| Protein Description | Required for mRNA export out of the nucleus. Probable RNA helicase that may regulate entry into mitosis by down-regulating the expression of other genes whose activity may be rate-limiting for entry into mitosis during embryogenesis. Binds to salivary gland chromosomes and modifies position effect variegation. Promotes an open chromatin structure that favors transcription during development by regulating the spread of heterochromatin.. | |
| Protein Sequence | MADNDDLLDYEDEEQTETTAVENQEAPKKDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMAIQKDEETLKSGTPHIVVGTPGRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKFMQDPMEVYVDDEAKLTLHGLQQHYVNLKENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRYQQFKDFQKRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQDRFDVNISELPEEIDLSTYIEGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Phosphorylation | PKKDVKGTYVSIHSS CCCCCCCCEEEEECC | 18.29 | 19429919 | |
| 35 | Phosphorylation | KKDVKGTYVSIHSSG CCCCCCCEEEEECCC | 10.81 | 19429919 | |
| 37 | Phosphorylation | DVKGTYVSIHSSGFR CCCCCEEEEECCCCH | 12.27 | 19429919 | |
| 40 | Phosphorylation | GTYVSIHSSGFRDFL CCEEEEECCCCHHHH | 30.41 | 19429919 | |
| 41 | Phosphorylation | TYVSIHSSGFRDFLL CEEEEECCCCHHHHC | 27.99 | 19429919 | |
| 135 | Acetylation | KEYERFSKYMPTVKV HHHHHHHHHCCCCEE | 42.74 | 21791702 | |
| 169 | Phosphorylation | TPHIVVGTPGRILAL CCEEEECCCHHHHHH | 15.80 | 22817900 | |
| 185 | Acetylation | RNKKLNLKLLKHFVL CCCCCCHHHHHHHHH | 51.18 | 21791702 | |
| 341 | Phosphorylation | QKRILVATNLFGRGM HHHHHHHHCCCCCCC | 25.60 | 21082442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DX39B_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DX39B_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DX39B_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ACADM_DROME | CG12262 | physical | 22036573 | |
| VATA2_DROME | Vha68-2 | physical | 22036573 | |
| TCPG_DROME | Cctgamma | physical | 22036573 | |
| OST48_DROME | Ost48 | physical | 22036573 | |
| ARL8_DROME | Gie | physical | 22036573 | |
| ERD2_DROME | KdelR | physical | 22036573 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
