dbPTM

GALE_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GALE_DROME
UniProt AC	Q9W0P5
Protein Name	UDP-glucose 4-epimerase {ECO:0000303\|PubMed:20519568, ECO:0000303\|PubMed:22654673}
Gene Name	Gale
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	350
Subcellular Localization
Protein Description	Catalyzes two distinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. [PubMed: 20519568]
Protein Sequence	MAPPTVLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYSSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHISGRIGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKALDKLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADATLADKKLGWKAERGIDKMCEDTWRWQSQNPNGYANK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
162	Acetylation	TSPYGKTKYFTEEIL CCCCCCCCCCCHHHH	41.68	21791702
223	Phosphorylation	VAVGRRPSLSVYGSD HHCCCCCCEEEECCC	31.31	19429919
304	Phosphorylation	YTLVDRRSGDVATCY EEEEECCCCCEEEEE	39.99	19429919
311	Phosphorylation	SGDVATCYADATLAD CCCEEEEEECCCHHH	11.80	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GALE_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GALE_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GALE_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GALE_DROME	Gale	physical	14605208
ACADM_DROME	CG12262	physical	22036573
ARL8_DROME	Gie	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GALE_DROME

Related Literatures of Post-Translational Modification