UniProt ID | GALE_DROME | |
---|---|---|
UniProt AC | Q9W0P5 | |
Protein Name | UDP-glucose 4-epimerase {ECO:0000303|PubMed:20519568, ECO:0000303|PubMed:22654673} | |
Gene Name | Gale | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 350 | |
Subcellular Localization | ||
Protein Description | Catalyzes two distinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. [PubMed: 20519568] | |
Protein Sequence | MAPPTVLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYSSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHISGRIGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKALDKLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADATLADKKLGWKAERGIDKMCEDTWRWQSQNPNGYANK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
162 | Acetylation | TSPYGKTKYFTEEIL CCCCCCCCCCCHHHH | 41.68 | 21791702 | |
223 | Phosphorylation | VAVGRRPSLSVYGSD HHCCCCCCEEEECCC | 31.31 | 19429919 | |
304 | Phosphorylation | YTLVDRRSGDVATCY EEEEECCCCCEEEEE | 39.99 | 19429919 | |
311 | Phosphorylation | SGDVATCYADATLAD CCCEEEEEECCCHHH | 11.80 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GALE_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GALE_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GALE_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GALE_DROME | Gale | physical | 14605208 | |
ACADM_DROME | CG12262 | physical | 22036573 | |
ARL8_DROME | Gie | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...