dbPTM

CATL_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CATL_DROME
UniProt AC	Q95029
Protein Name	Cathepsin L
Gene Name	Cp1
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	371
Subcellular Localization	Lysosome .
Protein Description	Important for the overall degradation of proteins in lysosomes. Essential for adult male and female fertility. May play a role in digestion..
Protein Sequence	MNHLGVFETRFRPRTRHKSQRAQLIPEQITMRTAVLLPLLALLAVAQAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
127	N-linked_Glycosylation	RQLMNGFNYTLHKQL HHHHHCCCHHHHHHH	30.22	-
202	Phosphorylation	SGVLVSLSEQNLVDC CCEEEECCCCCCEEC	29.63	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CATL_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CATL_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CATL_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
C1GLT_DROME	C1GalTA	physical	14605208
DX39B_DROME	Hel25E	physical	22036573
ACADM_DROME	CG12262	physical	22036573
CPR1_DROME	CG12163	physical	22036573
NFS1_DROME	CG12264	physical	22036573
RS10B_DROME	RpS10b	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CATL_DROME

Related Literatures of Post-Translational Modification