UniProt ID | CATL_DROME | |
---|---|---|
UniProt AC | Q95029 | |
Protein Name | Cathepsin L | |
Gene Name | Cp1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 371 | |
Subcellular Localization | Lysosome . | |
Protein Description | Important for the overall degradation of proteins in lysosomes. Essential for adult male and female fertility. May play a role in digestion.. | |
Protein Sequence | MNHLGVFETRFRPRTRHKSQRAQLIPEQITMRTAVLLPLLALLAVAQAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CATL_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CATL_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CATL_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
C1GLT_DROME | C1GalTA | physical | 14605208 | |
DX39B_DROME | Hel25E | physical | 22036573 | |
ACADM_DROME | CG12262 | physical | 22036573 | |
CPR1_DROME | CG12163 | physical | 22036573 | |
NFS1_DROME | CG12264 | physical | 22036573 | |
RS10B_DROME | RpS10b | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...