QCR9_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: QCR9_DROME
• UniProt AC: Q9XY35
• Protein Name: Cytochrome b-c1 complex subunit 9
• Gene Name: ox
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 55
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity)..
• Protein Sequence: MKVIYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIKGKYE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of QCR9_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of QCR9_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of QCR9_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of QCR9_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACADM_DROME	CG12262	physical	22036573
ERD2_DROME	KdelR	physical	22036573
KRH2_DROME	Kr-h2	physical	22036573
ATPG_DROME	ATPsyn-gamma	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.