UniProt ID | WASC3_DROME | |
---|---|---|
UniProt AC | Q9VLT8 | |
Protein Name | WASH complex subunit 3 {ECO:0000250|UniProtKB:Q9Y3C0} | |
Gene Name | CCDC53 {ECO:0000312|FlyBase:FBgn0031979} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 176 | |
Subcellular Localization | Early endosome . | |
Protein Description | Acts at least in part as component of the WASH complex which may regulate wash nucleation-promoting factor (NPF) activity and is required for its membrane targeting during endosomal sorting (By similarity). During embryogenesis, not involved in the wash-dependent developmental migration of hemocytes anteriorly from the tail. [PubMed: 25739458] | |
Protein Sequence | MDATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKFVEMERQLQKTEAALIILEAKLASIPTEHHVATEATEAPAISNQQRNEEASMVDTTEPPTTENPTEPELPPESVGVRACEDQRYRKFFKMVQVGVPAPAVKQKMQSEGLEPRILDTPDLILADGQRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of WASC3_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WASC3_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WASC3_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WASC3_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCD22_DROME | CG9951 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...