dbPTM

WASC3_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	WASC3_DROME
UniProt AC	Q9VLT8
Protein Name	WASH complex subunit 3 {ECO:0000250\|UniProtKB:Q9Y3C0}
Gene Name	CCDC53 {ECO:0000312\|FlyBase:FBgn0031979}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	176
Subcellular Localization	Early endosome .
Protein Description	Acts at least in part as component of the WASH complex which may regulate wash nucleation-promoting factor (NPF) activity and is required for its membrane targeting during endosomal sorting (By similarity). During embryogenesis, not involved in the wash-dependent developmental migration of hemocytes anteriorly from the tail. [PubMed: 25739458]
Protein Sequence	MDATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKFVEMERQLQKTEAALIILEAKLASIPTEHHVATEATEAPAISNQQRNEEASMVDTTEPPTTENPTEPELPPESVGVRACEDQRYRKFFKMVQVGVPAPAVKQKMQSEGLEPRILDTPDLILADGQRE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of WASC3_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of WASC3_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of WASC3_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of WASC3_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CCD22_DROME	CG9951	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of WASC3_DROME

Related Literatures of Post-Translational Modification