| UniProt ID | ESMC_DROME | |
|---|---|---|
| UniProt AC | Q01070 | |
| Protein Name | Enhancer of split mgamma protein | |
| Gene Name | E(spl)mgamma-HLH {ECO:0000312|FlyBase:FBgn0002735} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 205 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional repressor of genes that require a bHLH protein for their transcription. [PubMed: 24618901 May serve as a transcriptional regulator of the Achaete-scute complex (AS-C) genes] | |
| Protein Sequence | MSSLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWRPW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ESMC_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ESMC_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ESMC_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ESMC_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AST5_DROME | ac | physical | 9371806 | |
| AST4_DROME | sc | physical | 9371806 | |
| AST4_DROME | sc | physical | 9524128 | |
| AST8_DROME | ase | physical | 9371806 | |
| DA_DROME | da | physical | 9371806 | |
| ESMD_DROME | E(spl)mdelta-HLH | physical | 9371806 | |
| ESMC_DROME | E(spl)mgamma-HLH | physical | 9371806 | |
| ESMB_DROME | E(spl)mbeta-HLH | physical | 9371806 | |
| ESM5_DROME | E(spl)m5-HLH | physical | 9371806 | |
| ESM8_DROME | E(spl)m8-HLH | physical | 9371806 | |
| GROU_DROME | gro | physical | 16762837 | |
| GROU_DROME | gro | physical | 9371806 | |
| GROU_DROME | gro | physical | 9524128 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
