dbPTM

CISY_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CISY_DROME
UniProt AC	Q9W401
Protein Name	Probable citrate synthase, mitochondrial
Gene Name	kdn
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	464
Subcellular Localization	Mitochondrion matrix.
Protein Description	Plays a role in controlling neuronal activity and seizure susceptibility..
Protein Sequence	MSLYRISARKLSEAQKLPNVGAYVRMIAADGKSLRDVLAAKVPQEQERVKNFRKQHGATKMGETTIDMMYGGMRGIKALVTETSVLDADEGIRFRGLSIPECQKVLPAADGGTEPLPEGLFWLLLTGEVPTKSQVQQLSREWAERAALPQHVVTMLNNMPTTLHPMSQFAAAVTALNHDSKFAKAYSDGVHKSKYWEYVYEDSMDLIAKLPVVAATIYCNTYRGGKGSRSIDSSLDWSANFVKMLGYDNAPFTELMRLYLTIHSDHEGGNVSAHTVHLVGSALSDPYLSFAAGLNGLAGPLHGLANQEVLVWLRKLQKEAGNNPSEEQLKEYIWKTLKSGQVVPGYGHAVLRKTDPRYTCQREFALKHLPEDETFQLVSKIYKVVPPILTETGKVKNPWPNVDAHSGVLLQYYGMKEMNYYTVLFGVSRALGVLASLVWDRALGLPIERPKSFSTDLLVKMVQK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
184	Acetylation	NHDSKFAKAYSDGVH HCCHHHHHHHCCCCC	51.49	21791702
330	Acetylation	NPSEEQLKEYIWKTL CCCHHHHHHHHHHHH	48.44	21791702
335	Acetylation	QLKEYIWKTLKSGQV HHHHHHHHHHHCCCC	34.13	21791702
338	Acetylation	EYIWKTLKSGQVVPG HHHHHHHHCCCCCCC	58.74	21791702
338	Ubiquitination	EYIWKTLKSGQVVPG HHHHHHHHCCCCCCC	58.74	31113955
383	Acetylation	QLVSKIYKVVPPILT HHHHHHHHHCCCEEC	39.98	21791702
394	Acetylation	PILTETGKVKNPWPN CEECCCCCCCCCCCC	58.41	21791702
396	Ubiquitination	LTETGKVKNPWPNVD ECCCCCCCCCCCCCC	61.86	31113955

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CISY_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CISY_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CISY_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
OB56D_DROME	Obp56d	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CISY_DROME

Related Literatures of Post-Translational Modification