dbPTM

OB56D_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OB56D_DROME
UniProt AC	Q8SY61
Protein Name	General odorant-binding protein 56d
Gene Name	Obp56d
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	131
Subcellular Localization	Secreted.
Protein Description	Present in the aqueous fluid surrounding olfactory sensory dendrites and are thought to aid in the capture and transport of hydrophobic odorants into and through this fluid..
Protein Sequence	MKFLIVLSVILAISAAELQLSDEQKAVAHANGALCAQQEGITKDQAIALRNGNFDDSDPKVKCFANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKAVQAKCDATKGADKCDTAYQLFECYYKNRAHI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of OB56D_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OB56D_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OB56D_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OB56D_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
APLP_DROME	Rfabg	physical	22036573
NPLP2_DROME	Nplp2	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OB56D_DROME

Related Literatures of Post-Translational Modification