dbPTM

NPLP2_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NPLP2_DROME
UniProt AC	Q9VU58
Protein Name	Neuropeptide-like 2
Gene Name	Nplp2
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	86
Subcellular Localization	Secreted.
Protein Description
Protein Sequence	MAKLAICILVFALFALALSARVPREESNPAQEFLTKAQGDFNEFIEKLKALDAKKVEGLFKDGLNTVQEGLQKLNETFLQAPAAST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
27	Phosphorylation	ARVPREESNPAQEFL CCCCHHHCCHHHHHH	43.28	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NPLP2_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NPLP2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NPLP2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RL18A_DROME	RpL18A	physical	14605208
APLP_DROME	Rfabg	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NPLP2_DROME

Related Literatures of Post-Translational Modification