UniProt ID | RL18A_DROME | |
---|---|---|
UniProt AC | P41093 | |
Protein Name | 60S ribosomal protein L18a | |
Gene Name | RpL18A | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 177 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRAKGLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTRRVHVKQFHDSKIKFPLVQRVHHKGNRKLFSFRKPRTYFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
65 | Ubiquitination | TGEIVSIKQVYETSP CCCEEEEEEEEECCC | 26.63 | 31113955 | |
71 | Phosphorylation | IKQVYETSPVKIKNF EEEEEECCCEEEEEE | 18.76 | 21082442 | |
123 | Phosphorylation | RHRARAHSIQIIKVD HHHHCCCEEEEEEEC | 18.40 | 19429919 | |
168 | Phosphorylation | KGNRKLFSFRKPRTY CCCCCCEEECCCCCC | 34.28 | 27626673 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL18A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL18A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL18A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DYL1_DROME | ctp | physical | 14605208 | |
NOL9_DROME | CG8414 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...