RL18A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL18A_DROME
• UniProt AC: P41093
• Protein Name: 60S ribosomal protein L18a
• Gene Name: RpL18A
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 177
• Protein Sequence: MRAKGLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTRRVHVKQFHDSKIKFPLVQRVHHKGNRKLFSFRKPRTYFQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
65	Ubiquitination	TGEIVSIKQVYETSP CCCEEEEEEEEECCC	26.63	31113955
71	Phosphorylation	IKQVYETSPVKIKNF EEEEEECCCEEEEEE	18.76	21082442
123	Phosphorylation	RHRARAHSIQIIKVD HHHHCCCEEEEEEEC	18.40	19429919
168	Phosphorylation	KGNRKLFSFRKPRTY CCCCCCEEECCCCCC	34.28	27626673

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL18A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL18A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL18A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DYL1_DROME	ctp	physical	14605208
NOL9_DROME	CG8414	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.