DYL1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DYL1_DROME
• UniProt AC: Q24117
• Protein Name: Dynein light chain 1, cytoplasmic
• Gene Name: ctp
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 89
• Subcellular Localization: Cytoplasm, cytoskeleton .
• Protein Description: Acts as a non-catalytic accessory component of a dynein complex..
• Protein Sequence: MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DYL1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DYL1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DYL1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DYL1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARL2_DROME	Arl2	physical	14605208
DYHC_DROME	Dhc64C	genetic	15020714
DCTN1_DROME	Gl	genetic	15020714
DCTN1_DROME	Gl	genetic	15829565
DYL1_DROME	ctp	physical	11327818
SWA_DROME	swa	physical	10783235
SWA_DROME	swa	physical	15078108
DYIN_DROME	sw	physical	15581372

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.