| UniProt ID | SWA_DROME | |
|---|---|---|
| UniProt AC | P40688 | |
| Protein Name | Protein swallow | |
| Gene Name | swa | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 548 | |
| Subcellular Localization | Nucleus . Uniformly distributed in eggs, becomes localized to the nuclei during early mitotic divisions in early embryogenesis. Enters each nucleus at the beginning of mitosis, occupies a position complementary to that of condensed chromatin, and lea | |
| Protein Description | Has a role in localizing bicoid mRNA at the anterior margin of the oocyte during oogenesis, and a poorly characterized role in nuclear divisions in early embryogenesis.. | |
| Protein Sequence | MSLQDESFPTDELFDQLNNLSSSGARNTWFAEHHKPAVFERDTAPFLEICYADPDFDADGDVANKSAKTCVSDPVGRDQEDEDDYDEDVDGDDHKLGCEKAPLGSGRSSKAVSYQDIHSAYTKRRFQHVTSKVGQYIAEIQAQDQKRRNVKFAGFQRVNSMPESLTPTLQQVYVHDGDFKVDKNCQTHSNSDSNYNSNSNNSSSSFDRLLAENESLQQKINSLRVEAKRLQGFNEYVQERLDRKTDDFVKMKCNFETLRTELSECQQKLRRQQDNSQHHFMYHIRSATSAKATQTDFLVDTIPASGNVLVTPHPLGDLTYNSSKGSIELALLSVAPSARVAQNPVQVQRAIHPQSLDFSSVSTEADGSGSGEHRVETSSRALVRRTPAPNNSETSQPSSNDSAIEVEAHEEERPSSRRQWEQQGELISPRQWGQHEGMYYFDKRNNRVIEVMGFNISQGRNQSHDTIHNQSINDSQTRLLVHSMSMSHLEAHDHFRSKRTTLGSRMLRFLGPCVRCRNGDPLNRSNVTYKDGLPAMPEEEFVDQRNQR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 113 | Phosphorylation | GRSSKAVSYQDIHSA CCCCCCCCHHHHHHH | 23.18 | 22817900 | |
| 160 | Phosphorylation | AGFQRVNSMPESLTP CCCEECCCCCCHHCC | 32.62 | 21082442 | |
| 362 | Phosphorylation | SLDFSSVSTEADGSG CCCCCEEEECCCCCC | 23.60 | 22817900 | |
| 368 | Phosphorylation | VSTEADGSGSGEHRV EEECCCCCCCCCCCE | 30.27 | 22817900 | |
| 463 | Phosphorylation | ISQGRNQSHDTIHNQ ECCCCCCCCCCCCCC | 27.21 | 22817900 | |
| 466 | Phosphorylation | GRNQSHDTIHNQSIN CCCCCCCCCCCCCCC | 20.79 | 30478224 | |
| 471 | Phosphorylation | HDTIHNQSINDSQTR CCCCCCCCCCHHHHH | 28.77 | 22817900 | |
| 475 | Phosphorylation | HNQSINDSQTRLLVH CCCCCCHHHHHHHEE | 29.03 | 22817900 | |
| 483 | Phosphorylation | QTRLLVHSMSMSHLE HHHHHEEEECHHHHH | 12.69 | 22817900 | |
| 485 | Phosphorylation | RLLVHSMSMSHLEAH HHHEEEECHHHHHHH | 21.83 | 18327897 | |
| 487 | Phosphorylation | LVHSMSMSHLEAHDH HEEEECHHHHHHHHH | 20.01 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWA_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWA_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWA_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DYL1_DROME | ctp | physical | 10783235 | |
| DYL1_DROME | ctp | physical | 15078108 | |
| DYL1_DROME | ctp | physical | 17570393 | |
| DYL1_DROME | ctp | physical | 23914803 | |
| SWA_DROME | swa | physical | 15078108 | |
| SWA_DROME | swa | physical | 23914803 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-362; SER-368; SER-463;SER-471; SER-475; SER-483; SER-485 AND SER-487, AND MASS SPECTROMETRY. | |
