UniProt ID | TIMP_DROME | |
---|---|---|
UniProt AC | Q9VH14 | |
Protein Name | Tissue inhibitor of metalloproteinase {ECO:0000303|PubMed:10198170} | |
Gene Name | Timp {ECO:0000303|PubMed:10198170, ECO:0000312|EMBL:AAN13465.1, ECO:0000312|FlyBase:FBgn0025879} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 210 | |
Subcellular Localization | Secreted . | |
Protein Description | Metalloproteinase inhibitor that acts on both matrix metalloproteinases Mmp1 and Mmp2 in vitro. [PubMed: 14567681 Complexes with metalloproteinases and irreversibly inactivates them by binding to their catalytic zinc cofactor (By similarity Required for wing maturation which is the final step in morphogenesis of the adult fly] | |
Protein Sequence | MDLRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYKVHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKVYIVAGRMPTLNICSYYKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSPFGKCETNYSACMPHKVQTVNGVISRCRWRRTQLYRKCMSNP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TIMP_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIMP_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIMP_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIMP_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FMR1_DROME | Fmr1 | genetic | 21669931 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...