| UniProt ID | MGN_DROME | |
|---|---|---|
| UniProt AC | P49028 | |
| Protein Name | Protein mago nashi | |
| Gene Name | mago {ECO:0000312|FlyBase:FBgn0002736} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 147 | |
| Subcellular Localization | Nucleus . Cytoplasm . Part of the EJC assembled on mRNAs in the nucleus and remains part of the complex when mRNA moves into the cytoplasm. | |
| Protein Description | Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. [PubMed: 14973490] | |
| Protein Sequence | MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 105 | Phosphorylation | ISFTTSKTGSLVDVN EEEEECCCCCEEECC | 31.60 | 25749252 | |
| 107 | Phosphorylation | FTTSKTGSLVDVNRS EEECCCCCEEECCCC | 30.37 | 22817900 | |
| 115 | Acetylation | LVDVNRSKDPEGLRC EEECCCCCCCCCHHH | 74.25 | 21791702 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MGN_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MGN_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MGN_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RBM8A_DROME | tsu | physical | 11691839 | |
| RBM8A_DROME | tsu | physical | 22036573 | |
| PYM_DROME | wibg | physical | 22036573 | |
| OSKA_DROME | osk | genetic | 23948254 | |
| GRK_DROME | grk | physical | 24967911 | |
| RBM8A_DROME | tsu | physical | 12730685 | |
| RBM8A_DROME | tsu | physical | 20045686 | |
| RBM8A_DROME | tsu | physical | 24967911 | |
| RBM8A_DROME | tsu | physical | 12704080 | |
| RBM8A_DROME | tsu | physical | 14968132 | |
| PYM_DROME | wibg | physical | 14968132 | |
| BCD_DROME | bcd | physical | 24967911 | |
| IF4A3_DROME | eIF4AIII | physical | 24967911 | |
| OSKA_DROME | osk | physical | 24967911 | |
| NANOS_DROME | nos | physical | 24967911 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
