RBM8A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RBM8A_DROME
• UniProt AC: Q9V535
• Protein Name: RNA-binding protein 8A
• Gene Name: tsu {ECO:0000312|FlyBase:FBgn0033378}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 165
• Subcellular Localization: Nucleus . Cytoplasm . Part of the EJC assembled on mRNAs in the nucleus and remains part of the complex when mRNA moves into the cytoplasm.
• Protein Description: Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. [PubMed: 14973490]
• Protein Sequence: MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	RKGRGFGSDSNTREA CCCCCCCCCCCHHHH	35.29	19429919
42	Phosphorylation	GRGFGSDSNTREAIH CCCCCCCCCHHHHHH	41.62	22817900
44	Phosphorylation	GFGSDSNTREAIHSY CCCCCCCHHHHHHHH	33.56	25749252
50	Phosphorylation	NTREAIHSYERVRNE CHHHHHHHHHHHCCC	23.68	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RBM8A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RBM8A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RBM8A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MGN_DROME	mago	physical	14605208
MGN_DROME	mago	physical	11691839
PYM_DROME	wibg	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.