PP2A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PP2A_DROME
• UniProt AC: P23696
• Protein Name: Serine/threonine-protein phosphatase PP2A
• Gene Name: mts
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 309
• Protein Sequence: MEDKATTKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTRRTPDYFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
309	Methylation	RRTPDYFL------- CCCCCCCC-------	5.81	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PP2A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PP2A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PP2A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EIF3I_DROME	Trip1	physical	14605208
JMJD6_DROME	PSR	physical	22036573
LST8_DROME	Lst8	physical	22036573
TANT_DROME	tan	physical	22036573
SYFM_DROME	Aats-phe	physical	22036573
2AAA_DROME	Pp2A-29B	physical	22036573
EAF3_DROME	MRG15	physical	22036573
NUMB_DROME	numb	genetic	19502489
NUMB_DROME	numb	genetic	21558368
POLO_DROME	polo	genetic	19502489
SGO1_DROME	mei-S332	physical	24086141
ORB2_DROME	orb2	physical	24523662

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.