UniProt ID | PP2A_DROME | |
---|---|---|
UniProt AC | P23696 | |
Protein Name | Serine/threonine-protein phosphatase PP2A | |
Gene Name | mts | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 309 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEDKATTKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTRRTPDYFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
309 | Methylation | RRTPDYFL------- CCCCCCCC------- | 5.81 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP2A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EIF3I_DROME | Trip1 | physical | 14605208 | |
JMJD6_DROME | PSR | physical | 22036573 | |
LST8_DROME | Lst8 | physical | 22036573 | |
TANT_DROME | tan | physical | 22036573 | |
SYFM_DROME | Aats-phe | physical | 22036573 | |
2AAA_DROME | Pp2A-29B | physical | 22036573 | |
EAF3_DROME | MRG15 | physical | 22036573 | |
NUMB_DROME | numb | genetic | 19502489 | |
NUMB_DROME | numb | genetic | 21558368 | |
POLO_DROME | polo | genetic | 19502489 | |
SGO1_DROME | mei-S332 | physical | 24086141 | |
ORB2_DROME | orb2 | physical | 24523662 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...