UniProt ID | TANT_DROME | |
---|---|---|
UniProt AC | Q8T0D4 | |
Protein Name | Protein tantalus | |
Gene Name | tant {ECO:0000312|FlyBase:FBgn0028980} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 299 | |
Subcellular Localization | Nucleus . Cytoplasm . Chromosome . In embryos, it is predominantly cytoplasmic. In third instar larvae, it is predominantly nuclear or cytoplasmic depending on tissues. Colocalizes with Asx on many binding sites on polytene chromosomes, but does not | |
Protein Description | Potential cofactor involved in sensory organ development. Despite its interaction with the Polycomb group protein Asx, it does not regulate the expression of homeotic genes.. | |
Protein Sequence | MDNIVYDFAKITFQAKDNRSPTTNSNLSWQLNQMALSDMEEMQDTSEPIAPPESDDNVSSESHDSDDVDSQLSRCEDNDDDSDCISGSSRRSSTFGARAGVARRRMPARVSKDNFNRICSAIMKPIKKKQRKELNTNAQTLKSIEKIYTSRRMKKFTPTNLETIFEEPSDENAADAEDDSEECSISSQVKVVKVWGRKLRRAISFSDGLNKNKILSKRRRQKVKKTFGKRFALKKISMTEFHDRLNKSFDSAMLEGDDAEAGGSAEAVNIPKTSMTMEDIQLPTMSSQHQFLMQPAGFE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | Phosphorylation | ISGSSRRSSTFGARA CCCCCHHHCHHCCCC | 21082442 | ||
204 | Phosphorylation | RKLRRAISFSDGLNK HHHHHHHHCCCCCCH | 25749252 | ||
264 | Phosphorylation | DDAEAGGSAEAVNIP CCCCCCCCCCCCCCC | 18327897 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TANT_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TANT_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TANT_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
2AAA_DROME | Pp2A-29B | physical | 22036573 | |
ASX_DROME | Asx | genetic | 11397012 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...