UniProt ID | RALA_DROME | |
---|---|---|
UniProt AC | P48555 | |
Protein Name | Ras-related protein Ral-a | |
Gene Name | Rala | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 201 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side. Cleavage furrow . Midbody, Midbody ring . |
|
Protein Description | ||
Protein Sequence | MSKKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRRLKCTLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RALA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RALA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RALA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EIF3B_DROME | eIF3-S9 | physical | 14605208 | |
WNT5_DROME | Wnt5 | physical | 14605208 | |
RLIP_DROME | Rlip | physical | 15710747 | |
EXOC2_DROME | Sec5 | physical | 15710747 | |
CHRD1_DROME | CHORD | physical | 15710747 | |
PAX6_DROME | ey | physical | 15710747 | |
NOTCH_DROME | N | genetic | 21350007 | |
HEP_DROME | hep | genetic | 10427090 | |
EXOC2_DROME | Sec5 | genetic | 17000765 | |
MK14B_DROME | p38b | genetic | 17000765 | |
JRA_DROME | Jra | genetic | 17000765 | |
RAS3_DROME | R | genetic | 12529414 | |
EXOC7_DROME | Exo70 | genetic | 17000765 | |
DRONC_DROME | Nc | genetic | 17000765 | |
NEUR_DROME | neur | genetic | 21350007 | |
RAS1_DROME | Ras85D | genetic | 12529414 | |
DL_DROME | Dl | genetic | 21350007 | |
RLIP_DROME | Rlip | genetic | 17000765 | |
EXOC6_DROME | Sec15 | genetic | 17000765 | |
JNK_DROME | bsk | genetic | 10427090 | |
JNK_DROME | bsk | genetic | 17000765 | |
FOSLD_DROME | kay | genetic | 17000765 | |
FOSLA_DROME | kay | genetic | 17000765 | |
EXOC2_DROME | Sec5 | physical | 12529414 | |
RLIP_DROME | Rlip | physical | 12433364 | |
RLIP_DROME | Rlip | physical | 12529414 | |
RLIP_DROME | Rlip | physical | 14516694 | |
RLIP_DROME | Rlip | physical | 16581976 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...