dbPTM

RALA_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RALA_DROME
UniProt AC	P48555
Protein Name	Ras-related protein Ral-a
Gene Name	Rala
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	201
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side. Cleavage furrow . Midbody, Midbody ring .
Protein Description
Protein Sequence	MSKKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRRLKCTLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
198	Methylation	CKKRRLKCTLL---- HHHCCCCCEEC----	3.72	-
198	Geranylgeranylation	CKKRRLKCTLL---- HHHCCCCCEEC----	3.72	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RALA_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RALA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RALA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EIF3B_DROME	eIF3-S9	physical	14605208
WNT5_DROME	Wnt5	physical	14605208
RLIP_DROME	Rlip	physical	15710747
EXOC2_DROME	Sec5	physical	15710747
CHRD1_DROME	CHORD	physical	15710747
PAX6_DROME	ey	physical	15710747
NOTCH_DROME	N	genetic	21350007
HEP_DROME	hep	genetic	10427090
EXOC2_DROME	Sec5	genetic	17000765
MK14B_DROME	p38b	genetic	17000765
JRA_DROME	Jra	genetic	17000765
RAS3_DROME	R	genetic	12529414
EXOC7_DROME	Exo70	genetic	17000765
DRONC_DROME	Nc	genetic	17000765
NEUR_DROME	neur	genetic	21350007
RAS1_DROME	Ras85D	genetic	12529414
DL_DROME	Dl	genetic	21350007
RLIP_DROME	Rlip	genetic	17000765
EXOC6_DROME	Sec15	genetic	17000765
JNK_DROME	bsk	genetic	10427090
JNK_DROME	bsk	genetic	17000765
FOSLD_DROME	kay	genetic	17000765
FOSLA_DROME	kay	genetic	17000765
EXOC2_DROME	Sec5	physical	12529414
RLIP_DROME	Rlip	physical	12433364
RLIP_DROME	Rlip	physical	12529414
RLIP_DROME	Rlip	physical	14516694
RLIP_DROME	Rlip	physical	16581976

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RALA_DROME

Related Literatures of Post-Translational Modification