UniProt ID | CHRD1_DROME | |
---|---|---|
UniProt AC | Q9VCC0 | |
Protein Name | Cysteine and histidine-rich domain-containing protein | |
Gene Name | CHORD | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 354 | |
Subcellular Localization | ||
Protein Description | Regulates centrosome duplication.. | |
Protein Sequence | MEQCYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKPPEPEKPVKDESDKDEVIEVRAPIREALPRPPIDSPLTVIQPTVAPALKDMVFAVKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRTSDFSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRLHVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKKSQVEEKKKQEESDEEFFDLDDIKAETSFRLSEMSMQSPNNLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Phosphorylation | EKPVKDESDKDEVIE CCCCCCCCCCCCEEE | 61.16 | 22817900 | |
324 | Phosphorylation | EKKKQEESDEEFFDL HHHHHHCCCHHCCCH | 49.96 | 21082442 | |
339 | Phosphorylation | DDIKAETSFRLSEMS HHHHHHCHHHHHHHH | 10.40 | 22817900 | |
343 | Phosphorylation | AETSFRLSEMSMQSP HHCHHHHHHHHCCCC | 27.31 | 19429919 | |
349 | Phosphorylation | LSEMSMQSPNNLD-- HHHHHCCCCCCCC-- | 22.43 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHRD1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHRD1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHRD1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324 AND SER-339, ANDMASS SPECTROMETRY. | |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, AND MASSSPECTROMETRY. |