| UniProt ID | NEUR_DROME | |
|---|---|---|
| UniProt AC | P29503 | |
| Protein Name | Protein neuralized | |
| Gene Name | neur | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 754 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in neurogenesis. Interacts with other neurogenic proteins in the specification of the neuroblast versus epidermoblast cell fate.. | |
| Protein Sequence | MGLSDIPANYMQGSHPHLTLHPQQQHHQNQQHLQHLQQMQQLHNAMPTPAQQAAQVLAMESNELLMSTKDKLSSKKKMHLLKKIKKRFGLVRRSPSSCPGPNNLPPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFLDSRIYMYQQQPAAIPMATVPAQQQQMPQPAANASSALNSHHPHQQSRRSLPGHTAAIEHDLERHVMPSLQSLHLAGNGGSVASVEQAAIAHDLANGLPPLRYNANGRLIPVPFHNTKGRNVRLSQDRFVASRTESDFCQGYVFTARPIRIGEKLIVQVLKTEQMYVGALALGLTSCNPAMLQPNDLPNDSDFLLDRPEYWVVSKDIAAAPQRGDEIAFFVAPNGEVSISKNNGPAVVVMHVDQSLQLWAFLDVYGSTQSLRMFRQQLPNMVAYPSQPQVNVNASSSSACNAASTSRMLPMTESMSSLNAGATAKLLHHPSQLSVAQSTSTLASAGGVNGSRMISMPSNGDILQIQPNGGGTVLVVNLPPASSSHDINGQLAARPTATVTSSGVLAGACSSGTLISTTSSQYIEQPIANSTNNAANKWKDSLSDQQSTDSSAECTICYENPIDSVLYMCGHMCMCYDCAIEQWRGVGGGQCPLCRAVIRDVIRTYTT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 307 | Phosphorylation | PHQQSRRSLPGHTAA CCHHCCCCCCCCCHH | 37.49 | 19429919 | |
| 338 | Phosphorylation | HLAGNGGSVASVEQA EECCCCCCCCCHHHH | 18.86 | 22817900 | |
| 341 | Phosphorylation | GNGGSVASVEQAAIA CCCCCCCCHHHHHHH | 24.83 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEUR_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEUR_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEUR_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DL_DROME | Dl | physical | 17065551 | |
| ESMA_DROME | E(spl)malpha-BFM | physical | 16459303 | |
| ESM4_DROME | E(spl)m4-BFM | physical | 16459303 | |
| ESM6_DROME | E(spl)m6-BFM | physical | 16459303 | |
| DL_DROME | Dl | physical | 16459303 | |
| NEUL4_HUMAN | NEURL4 | physical | 26355680 | |
| DLL1_RAT | Dll1 | physical | 26355680 | |
| HERC2_DROME | HERC2 | genetic | 26355680 | |
| MIB_DROME | mib1 | genetic | 16093323 | |
| MIB_DROME | mib1 | genetic | 15829515 | |
| UBCD1_DROME | eff | genetic | 11740940 | |
| DL_DROME | Dl | genetic | 16093323 | |
| HLES_DROME | H | genetic | 6443124 | |
| SERR_DROME | Ser | genetic | 16093323 | |
| NEUR_DROME | neur | physical | 23045391 | |
| DL_DROME | Dl | physical | 23045391 | |
| DL_DROME | Dl | physical | 22162135 | |
| SERR_DROME | Ser | physical | 17006545 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-338 AND SER-341, ANDMASS SPECTROMETRY. | |
