UniProt ID | UBCD1_DROME | |
---|---|---|
UniProt AC | P25867 | |
Protein Name | Ubiquitin-conjugating enzyme E2-17 kDa | |
Gene Name | eff | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 147 | |
Subcellular Localization | ||
Protein Description | Catalyzes the covalent attachment of ubiquitin to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. Required for proper telomere behavior during cell divisions and possibly for ubiquitination of proteins involved in postmeiotic stages of spermatogenesis. Deletion mutations are lethal in homozygotes.. | |
Protein Sequence | MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Acetylation | MALKRINKELQDLGR CCHHHHHHHHHHCCC | 58.38 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBCD1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBCD1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBCD1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NCAH_DROME | Nca | physical | 14605208 | |
SINA_DROME | sina | physical | 9267026 | |
TTKB_DROME | ttk | physical | 9267026 | |
TTKA_DROME | ttk | physical | 9267026 | |
CCNA_DROME | CycA | genetic | 19906849 | |
CCNA_DROME | CycA | genetic | 10644410 | |
DIAP1_DROME | th | physical | 12021769 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...