UniProt ID | NCAH_DROME | |
---|---|---|
UniProt AC | P42325 | |
Protein Name | Neurocalcin homolog | |
Gene Name | Nca | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 190 | |
Subcellular Localization | ||
Protein Description | Inhibits the phosphorylation of rhodopsin in a calcium-dependent manner. Probably binds two or three calcium ions.. | |
Protein Sequence | MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQSH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NCAH_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NCAH_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NCAH_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Myristoylation | |
Reference | PubMed |
"Drosophila neurocalcin, a fatty acylated, Ca2+-binding protein thatassociates with membranes and inhibits in vitro phosphorylation ofbovine rhodopsin."; Faurobert E., Chen C.-K., Hurley J.B., Teng D.H.-F.; J. Biol. Chem. 271:10256-10262(1996). Cited for: FUNCTION, MASS SPECTROMETRY, AND MYRISTOYLATION AT GLY-2. |