dbPTM

SINA_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SINA_DROME
UniProt AC	P21461
Protein Name	E3 ubiquitin-protein ligase sina
Gene Name	sina
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	314
Subcellular Localization	Cytoplasm. Nucleus.
Protein Description	E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk). [PubMed: 9267026]
Protein Sequence	MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SINA_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SINA_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SINA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SINA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBCD1_DROME	eff	physical	9267026
PHYL_DROME	phyl	physical	9267026
TTKB_DROME	ttk	physical	9267026
TTKA_DROME	ttk	physical	9267026
PHYL_DROME	phyl	physical	9267027
UBCD1_DROME	eff	genetic	12215542
PHYL_DROME	phyl	physical	12215542
TTKB_DROME	ttk	physical	12215542
TTKA_DROME	ttk	physical	12215542
SINA_DROME	sina	physical	12215542
DCC_HUMAN	DCC	physical	9334332
PHYL_DROME	phyl	physical	12626763
EBI_DROME	ebi	physical	17561381
STAR_DROME	S	genetic	9475739
AFF4_DROME	lilli	genetic	9475739
AFF4_DROME	lilli	genetic	11171404
PNUT_DROME	pnut	genetic	7972125
PNUT_DROME	pnut	genetic	8181057
PHYL_DROME	phyl	genetic	11526076
HSP83_DROME	Hsp83	genetic	7972125
HSP83_DROME	Hsp83	genetic	9475739
FRY_DROME	fry	genetic	9475739
ELL_DROME	Su(Tpl)	genetic	9475739
PROS_DROME	pros	genetic	8804311
UBCD1_DROME	eff	genetic	9475739
GLAS_DROME	gl	genetic	7972125
GLAS_DROME	gl	genetic	9475739
TTKB_DROME	ttk	genetic	10495274
TTKA_DROME	ttk	genetic	10495274
TTKB_DROME	ttk	genetic	11526076
TTKA_DROME	ttk	genetic	11526076
ERKA_DROME	rl	genetic	7972125
PHYL_DROME	phyl	physical	8804311
SINA_DROME	sina	physical	9267027
SINA_DROME	sina	physical	9267026
TTKB_DROME	ttk	physical	9267027
TTKA_DROME	ttk	physical	9267027

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SINA_DROME

Related Literatures of Post-Translational Modification