dbPTM

ERKA_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERKA_DROME
UniProt AC	P40417
Protein Name	Mitogen-activated protein kinase ERK-A
Gene Name	rl {ECO:0000303\|PubMed:8157002, ECO:0000312\|FlyBase:FBgn0003256}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	376
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway to regulate poliferation, differentiation and effect cell fate decisions in various tissues. [PubMed: 8157002]
Protein Sequence	MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKERQPDNAP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
198	Phosphorylation	HDHTGFLTEYVATRW CCCCCHHHHHHHHCC	50.45	19429919
200	Phosphorylation	HTGFLTEYVATRWYR CCCHHHHHHHHCCCC	2.84	19429919
203	Phosphorylation	FLTEYVATRWYRAPE HHHHHHHHCCCCCCE	1.66	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERKA_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERKA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERKA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ERKA_DROME	rl	physical	14605208
AFF4_DROME	lilli	genetic	11171403
HP1_DROME	Su(var)205	genetic	10835392
JRA_DROME	Jra	genetic	8670899
JRA_DROME	Jra	genetic	9224723
MGN_DROME	mago	genetic	20946983
EGFR_DROME	Egfr	genetic	8124723
EGFR_DROME	Egfr	genetic	9383058
SRF_DROME	bs	genetic	9550715
PTP61_DROME	Ptp61F	genetic	24752400
GIL_DROME	aos	genetic	8812105
HID_DROME	W	genetic	11832242
DUSK3_DROME	Mkp3	genetic	12810595
EGON_DROME	eg	genetic	12049770
PUM_DROME	pum	genetic	22514614
7UP1_DROME	svp	genetic	12049770
7UP2_DROME	svp	genetic	12049770
OSA_DROME	osa	genetic	19306864
T2AG_DROME	TfIIA-S	genetic	8557194
ASH2_DROME	ash2	genetic	15371308
TLL_DROME	tll	genetic	12049770
ANKHM_DROME	mask	genetic	11782402
FOSLD_DROME	kay	genetic	11410534
FOSLA_DROME	kay	genetic	11410534
FOSLD_DROME	kay	genetic	12049770
FOSLA_DROME	kay	genetic	12049770
CH60_DROME	Hsp60	physical	22028469
LTOR3_DROME	CG5110	physical	21401930
JRA_DROME	Jra	physical	11410534
GNAQ_DROME	Galphaq	physical	22028469
FOSLD_DROME	kay	physical	11410534
FOSLA_DROME	kay	physical	11410534
CORTO_DROME	corto	physical	21401930
CDK2_DROME	cdc2c	physical	22028469

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERKA_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-248 AND TYR-250, ANDMASS SPECTROMETRY.	18327897 [Abstract]