UniProt ID | ERKA_DROME | |
---|---|---|
UniProt AC | P40417 | |
Protein Name | Mitogen-activated protein kinase ERK-A | |
Gene Name | rl {ECO:0000303|PubMed:8157002, ECO:0000312|FlyBase:FBgn0003256} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 376 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway to regulate poliferation, differentiation and effect cell fate decisions in various tissues. [PubMed: 8157002] | |
Protein Sequence | MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKERQPDNAP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
198 | Phosphorylation | HDHTGFLTEYVATRW CCCCCHHHHHHHHCC | 50.45 | 19429919 | |
200 | Phosphorylation | HTGFLTEYVATRWYR CCCHHHHHHHHCCCC | 2.84 | 19429919 | |
203 | Phosphorylation | FLTEYVATRWYRAPE HHHHHHHHCCCCCCE | 1.66 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERKA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERKA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERKA_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-248 AND TYR-250, ANDMASS SPECTROMETRY. |