| UniProt ID | GNAQ_DROME | |
|---|---|---|
| UniProt AC | P23625 | |
| Protein Name | G protein alpha q subunit | |
| Gene Name | Galphaq | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 353 | |
| Subcellular Localization | ||
| Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Could be the transducin analog, an amplifier and one of the transducers of a visual impulse that performs the coupling between opsin and cGMP-phosphodiesterase. Could mediate a subset of olfactory and gustatory responses.. | |
| Protein Sequence | MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAKQFVLKKYLACNPDPERQCYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNLG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | S-palmitoylation | -----MECCLSEEAK -----CCCCCCHHHH | 2.46 | - | |
| 4 | S-palmitoylation | ----MECCLSEEAKE ----CCCCCCHHHHH | 2.74 | - | |
| 348 | Ubiquitination | TIMQNALKEFNLG-- HHHHHHHHHCCCC-- | 58.82 | 31113955 | |
| 391 | Ubiquitination | --------------------------------------------- --------------------------------------------- | 31113955 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNAQ_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNAQ_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNAQ_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PIPA_DROME | norpA | physical | 10644758 | |
| TRP_DROME | trp | physical | 10644758 | |
| KPC2_DROME | inaC | physical | 10644758 | |
| INAD_DROME | inaD | physical | 10644758 | |
| DGK2_DROME | rdgA | genetic | 12441057 | |
| PIP1_DROME | Plc21C | genetic | 18448651 | |
| SY65_DROME | Syt1 | genetic | 26544939 | |
| RAB3_DROME | Rab3 | genetic | 26544939 | |
| GBB2_DROME | Gbeta76C | genetic | 16260498 | |
| ITPR_DROME | Itp-r83A | genetic | 26544939 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
