dbPTM

RAB3_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAB3_DROME
UniProt AC	P25228
Protein Name	Ras-related protein Rab-3
Gene Name	Rab3
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	220
Subcellular Localization	Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.
Protein Description	Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal (By similarity)..
Protein Sequence	MASGGDPKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Phosphorylation	KLLIIGNSSVGKTSF EEEEECCCCCCCEEE	22.61	27794539
31	Phosphorylation	LLIIGNSSVGKTSFL EEEECCCCCCCEEEE	38.60	27794539
187	Phosphorylation	DIICDKMSESLDADP HHHHHHCCCCCCCCC	29.76	27794539
189	Phosphorylation	ICDKMSESLDADPTL HHHHCCCCCCCCCCC	25.00	27794539
218	Geranylgeranylation	QGTPNANCNC----- CCCCCCCCCC-----	5.23	14722103
218	Geranylgeranylation	QGTPNANCNC----- CCCCCCCCCC-----	5.23	14722103
220	Geranylgeranylation	TPNANCNC------- CCCCCCCC-------	6.86	14722103
220	Geranylgeranylation	TPNANCNC------- CCCCCCCC-------	6.86	14722103
220	Methylation	TPNANCNC------- CCCCCCCC-------	6.86	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAB3_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAB3_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAB3_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MSS4_DROME	CG7787	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAB3_DROME

Related Literatures of Post-Translational Modification