dbPTM

T2AG_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	T2AG_DROME
UniProt AC	P52656
Protein Name	Transcription initiation factor IIA subunit 2
Gene Name	TfIIA-S
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	106
Subcellular Localization	Nucleus.
Protein Description	TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. [PubMed: 7958898 TFIIA in a complex with TBP mediates transcriptional activity]
Protein Sequence	MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNTYRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGKSGEF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of T2AG_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of T2AG_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of T2AG_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of T2AG_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TF2AA_DROME	TfIIA-L	physical	14605208
TF2AA_DROME	TfIIA-L	physical	7958898

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of T2AG_DROME

Related Literatures of Post-Translational Modification