UniProt ID | TF2AA_DROME | |
---|---|---|
UniProt AC | P52654 | |
Protein Name | Transcription initiation factor IIA subunit 1 | |
Gene Name | TfIIA-L | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 366 | |
Subcellular Localization | Nucleus. | |
Protein Description | TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.. | |
Protein Sequence | MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLASKAVELSPDSGDGSHPPPIVANNPKSHKAANAKAKKAAAATAVTSHQHIGGNSSMSSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQKQQQAASSGQGSIPIVATLDPNRIMPVNITLPSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLAAAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKSNGDAEW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
265 | Phosphorylation | LDGALDSSDEDESEE HCCCCCCCCCCCCCC | 44.69 | - | |
306 | Phosphorylation | AEEEPLNSEDDVTDE HHHCCCCCCCCCCCH | 50.51 | - | |
353 | Acetylation | GIMNMRGKDYVFQKS CCCCCCCCCEEEECC | 35.21 | 21791702 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TF2AA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TF2AA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VND_DROME | vnd | physical | 14605208 | |
PP11_DROME | Pp1alpha-96A | physical | 14605208 | |
RL22_DROME | RpL22 | physical | 14605208 | |
RS8_DROME | RpS8 | physical | 14605208 | |
DEAF1_DROME | Deaf1 | physical | 14605208 | |
TAF4_DROME | Taf4 | physical | 8224849 | |
T2AG_DROME | TfIIA-S | physical | 7958898 | |
TF2AA_DROME | TfIIA-L | physical | 7958898 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...