UniProt ID | RL22_DROME | |
---|---|---|
UniProt AC | P50887 | |
Protein Name | 60S ribosomal protein L22 | |
Gene Name | RpL22 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 299 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAPTAKTNKGDTKTAAAKPAEKKAAPAAAAAKGKVEKPKAEAAKPAAAAAKNVKKASEAAKDVKAAAAAAKPAAAKPAAAKPAAASKDAGKKAPAAAAPKKDAKAAAAPAPAKAAPAKKAASTPAAAPPAKKAAPAKAAAPAAAAPAPAAAAPAVAKPAPKPKAKAAPAPSKVVKKNVLRGKGQKKKKVSLRFTIDCTNIAEDSIMDVADFEKYIKARLKVNGKVNNLGNNVTFERSKLKLIVSSDVHFSKAYLKYLTKKYLKKNSLRDWIRVVANEKDSYELRYFRISSNDDEDDDAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
57 | Phosphorylation | AKNVKKASEAAKDVK HHHHHHHHHHHHHHH | 36.33 | 22817900 | |
86 | Phosphorylation | AAKPAAASKDAGKKA HCCCCHHCCHHCCCC | 26.75 | 22817900 | |
122 | Phosphorylation | APAKKAASTPAAAPP CCCHHHCCCCCCCCC | 39.52 | 22817900 | |
123 | Phosphorylation | PAKKAASTPAAAPPA CCHHHCCCCCCCCCH | 16.54 | 21082442 | |
172 | Acetylation | KAAPAPSKVVKKNVL CCCCCCCHHHHHHHH | 50.41 | 21791702 | |
289 | Phosphorylation | ELRYFRISSNDDEDD EEEEEEEECCCCCCC | 20.87 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL22_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL22_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL22_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RL22_DROME | RpL22 | physical | 14605208 | |
NOM1_DROME | CG9004 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...