| UniProt ID | YAP1_DROME | |
|---|---|---|
| UniProt AC | Q45VV3 | |
| Protein Name | Transcriptional coactivator yorkie {ECO:0000305} | |
| Gene Name | yki | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 395 | |
| Subcellular Localization | Cytoplasm . Nucleus . Predominantly cytoplasmic (PubMed:18313299, PubMed:18256197, PubMed:19900439). sd promotes its nuclear localization (PubMed:18313299). 14-3-3epsilon, 14-3-3zeta and wts inhibit its nuclear localization (PubMed:18256197, PubMed:1 | |
| Protein Description | Transcriptional coactivator which is the critical downstream regulatory target in the Hippo/SWH (Sav/Wts/Hpo) signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki) oncoprotein. The Hippo/SWH signaling pathway inhibits the activity of the transcriptional complex formed by Scalloped (sd) and Yki and the target genes of this pathway include cyclin-E (cycE), diap1 and bantam. Regulates the expression of G1/S-specific cyclin-E (CycE) and apoptosis 1 inhibitor (th), thereby promoting cell proliferation and inhibiting apoptosis. Required for transcriptional activity of scalloped (sd) in wing imaginal disks. Induces expression of expression of vestigial (vg) in wing and haltere disks and the expression of transcription factor E2f (E2f).. | |
| Protein Sequence | MLTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCSNLFNDAQAIVNPPSSHKPDDLEWYKIN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Phosphorylation | IDDEDMLSPIKSNNL CCCHHHCCCCCCCCE | 19429919 | ||
| 74 | Phosphorylation | RMRKLPNSFFTPPAP HHHCCCCCCCCCCCC | 21082442 | ||
| 82 | Phosphorylation | FFTPPAPSHSRANSA CCCCCCCCCCCCCCC | 19429919 | ||
| 84 | Phosphorylation | TPPAPSHSRANSADS CCCCCCCCCCCCCCC | 19429919 | ||
| 88 | Phosphorylation | PSHSRANSADSTYDA CCCCCCCCCCCCCCC | 19429919 | ||
| 91 | Phosphorylation | SRANSADSTYDAGSQ CCCCCCCCCCCCCCC | 29892262 | ||
| 92 | Phosphorylation | RANSADSTYDAGSQS CCCCCCCCCCCCCCC | 22668510 | ||
| 97 | Phosphorylation | DSTYDAGSQSSINIG CCCCCCCCCCCEECC | 19429919 | ||
| 99 | Phosphorylation | TYDAGSQSSINIGNK CCCCCCCCCEECCCC | 23607784 | ||
| 100 | Phosphorylation | YDAGSQSSINIGNKA CCCCCCCCEECCCCC | 19060867 | ||
| 108 | Phosphorylation | INIGNKASIVQQPDG EECCCCCEEEECCCC | 19429919 | ||
| 117 | Phosphorylation | VQQPDGQSPIAAIPQ EECCCCCCCCCEECE | 19429919 | ||
| 130 | Phosphorylation | PQLQIQPSPQHSRLA CEEEECCCCCCCHHH | 21082442 | ||
| 134 | Phosphorylation | IQPSPQHSRLAIHHS ECCCCCCCHHHHCCH | 21082442 | ||
| 145 | Phosphorylation | IHHSRARSSPASLQQ HCCHHHCCCCCHHHH | 19429919 | ||
| 146 | Phosphorylation | HHSRARSSPASLQQN CCHHHCCCCCHHHHH | 19429919 | ||
| 149 | Phosphorylation | RARSSPASLQQNYNV HHCCCCCHHHHHHCH | 19060867 | ||
| 227 | Phosphorylation | TVHKKQRSYDVISPI HHCHHCCCCCCCCHH | 19429919 | ||
| 228 | Phosphorylation | VHKKQRSYDVISPIQ HCHHCCCCCCCCHHH | 19429919 | ||
| 232 | Phosphorylation | QRSYDVISPIQLNRQ CCCCCCCCHHHHHHH | 19429919 | ||
| 335 | Phosphorylation | FINHIDRTTSWNDPR EEECCCCCCCCCCCH | 19429919 | ||
| 336 | Phosphorylation | INHIDRTTSWNDPRM EECCCCCCCCCCCHH | 19429919 | ||
| 337 | Phosphorylation | NHIDRTTSWNDPRMQ ECCCCCCCCCCCHHC | 19429919 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 168 | S | Phosphorylation | Kinase | WTS | Q9VA38 | GPS |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YAP1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YAP1_DROME !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
