UniProt ID | MED31_DROME | |
---|---|---|
UniProt AC | Q8IH24 | |
Protein Name | Mediator of RNA polymerase II transcription subunit 31 | |
Gene Name | MED31 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 204 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for activated transcription of the MtnA gene.. | |
Protein Sequence | MAKMYGKGKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGESAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIKLELN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Acetylation | -----MAKMYGKGKT -----CCCCCCCCCC | 31.21 | 21791702 | |
7 | Acetylation | -MAKMYGKGKTAIES -CCCCCCCCCCCCCC | 39.48 | 21791702 | |
9 | Acetylation | AKMYGKGKTAIESEE CCCCCCCCCCCCCHH | 37.96 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED31_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED31_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED31_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEPT1_DROME | Sep1 | physical | 14605208 | |
MED7_DROME | MED7 | physical | 22036573 | |
MED17_DROME | MED17 | physical | 22036573 | |
MED13_DROME | skd | genetic | 18083158 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...