UniProt ID | 1433E_DROME | |
---|---|---|
UniProt AC | P92177 | |
Protein Name | 14-3-3 protein epsilon | |
Gene Name | 14-3-3epsilon | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 262 | |
Subcellular Localization | ||
Protein Description | Positively regulates Ras-mediated pathways. Acts downstream or parallel to Raf, but upstream of nuclear factors in Ras signaling. Three mutants have been isolated, that suppress the rough eye phenotype caused by mutated Ras1 (sev-Ras1 v12). Inhibits yki activity by restricting its nuclear localization.. | |
Protein Sequence | MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQIQDVEDQDVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | VEERNLLSVAYKNVI HHHHHHHHHHHHHHH | 14.10 | 22668510 | |
49 | Phosphorylation | RNLLSVAYKNVIGAR HHHHHHHHHHHHHHH | 10.84 | 19429919 | |
69 | Acetylation | IITSIEQKEENKGAE EEEEHHHHHHCCCHH | 54.96 | 21791702 | |
78 | Acetylation | ENKGAEEKLEMIKTY HCCCHHHHHHHHHHH | 41.05 | 21791702 | |
83 | Acetylation | EEKLEMIKTYRGQVE HHHHHHHHHHHHHHH | 37.89 | 21791702 | |
91 | Acetylation | TYRGQVEKELRDICS HHHHHHHHHHHHHHH | 64.29 | 21791702 | |
139 | Phosphorylation | LAEFATGSDRKDAAE HHHHHCCCCHHHHHH | 29.86 | 22817900 | |
208 | Phosphorylation | DAIAELDTLSEESYK HHHHHHHCCCHHHCC | 44.82 | 29892262 | |
210 | Phosphorylation | IAELDTLSEESYKDS HHHHHCCCHHHCCCH | 41.22 | 19429919 | |
213 | Phosphorylation | LDTLSEESYKDSTLI HHCCCHHHCCCHHHH | 33.17 | 19429919 | |
262 | Phosphorylation | DVEDQDVS------- CCCCCCCC------- | 42.67 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 1433E_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 1433E_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 1433E_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SH3BG_DROME | Sh3beta | physical | 22036573 | |
TNG2_DROME | Tango2 | physical | 22036573 | |
RS27A_DROME | RpS27A | physical | 24292889 | |
ITA1_DROME | mew | genetic | 22500634 | |
ITA2_DROME | if | genetic | 22500634 | |
1433Z_DROME | 14-3-3zeta | genetic | 12431373 | |
1433Z_DROME | 14-3-3zeta | genetic | 17660572 | |
RAS2_DROME | Ras64B | genetic | 22500634 | |
FOXO_DROME | foxo | genetic | 18665908 | |
RHEB_DROME | Rheb | physical | 27151460 | |
YAP1_DROME | yki | physical | 26887950 | |
NDE1_DROME | nudE | physical | 23987511 | |
TCTP_DROME | Tctp | physical | 27151460 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-262, AND MASSSPECTROMETRY. |