UniProt ID | SH3BG_DROME | |
---|---|---|
UniProt AC | Q9NFP5 | |
Protein Name | SH3 domain-binding glutamic acid-rich protein homolog | |
Gene Name | Sh3beta | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 158 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQIELKQENGDAKKEEAETEAEDKKTEAGDGDVDVKEEAAEKAEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | KVYVSGMSGNKEVKK EEEEECCCCCHHHHH | 42.62 | 22817900 | |
30 | Acetylation | VLMILDSKNIKYDTV EEEEEECCCCCEEEC | 63.46 | 21791702 | |
33 | Acetylation | ILDSKNIKYDTVDIT EEECCCCCEEECCCC | 46.60 | 21791702 | |
48 | Acetylation | EPGKESEKELMQNKS CCCCHHHHHHHHCCC | 66.48 | 21791702 | |
109 | Phosphorylation | KLAPADTTAVSTAQI HHCCCCCCCEEEEEE | 26.13 | 17372656 | |
132 | Phosphorylation | AKKEEAETEAEDKKT HHHHHHHHHHHHHHC | 47.76 | 19429919 | |
139 | Phosphorylation | TEAEDKKTEAGDGDV HHHHHHHCCCCCCCC | 36.49 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SH3BG_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SH3BG_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SH3BG_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
THIO2_DROME | Trx-2 | physical | 22036573 | |
NACA_DROME | Nacalpha | physical | 22036573 | |
YC17_DROME | CG16817 | physical | 22036573 | |
PSA1_DROME | Prosalpha6 | physical | 22036573 | |
TCTP_DROME | Tctp | physical | 22036573 | |
PGK_DROME | Pgk | physical | 22036573 | |
TERA_DROME | TER94 | physical | 22036573 | |
Y9705_DROME | CG9705 | physical | 22036573 | |
JUPIT_DROME | Jupiter | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-109, AND MASSSPECTROMETRY. |