dbPTM

Y9705_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y9705_DROME
UniProt AC	Q9VVA0
Protein Name	Cold shock domain-containing protein CG9705
Gene Name	CG9705
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	143
Subcellular Localization
Protein Description
Protein Sequence	MTEPRTPEKLLAAKPPVLHHNSHSPNASLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTPEVHHKWEEPFYGGSSPAK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	PPVLHHNSHSPNASL CCEECCCCCCCCCCC	22.45	19429919
24	Phosphorylation	VLHHNSHSPNASLQL EECCCCCCCCCCCCC	21.48	19429919
28	Phosphorylation	NSHSPNASLQLPSPI CCCCCCCCCCCCCCE	24.24	19429919
33	Phosphorylation	NASLQLPSPIITRRT CCCCCCCCCEEECCC	37.01	19429919
37	Phosphorylation	QLPSPIITRRTRTAS CCCCCEEECCCCCCC	18.15	19429919
44	Phosphorylation	TRRTRTASTSARALE ECCCCCCCHHHHHHC	23.45	19429919
45	Phosphorylation	RRTRTASTSARALEN CCCCCCCHHHHHHCC	24.76	19429919
46	Phosphorylation	RTRTASTSARALENP CCCCCCHHHHHHCCC	17.17	19429919
124	Phosphorylation	HVQISHLTPEVHHKW EEEECCCCCCCCCCC	16.39	21082442
136	Phosphorylation	HKWEEPFYGGSSPAK CCCCCCCCCCCCCCC	31.15	19429919
139	Phosphorylation	EEPFYGGSSPAK--- CCCCCCCCCCCC---	28.87	19429919
140	Phosphorylation	EPFYGGSSPAK---- CCCCCCCCCCC----	31.95	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y9705_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y9705_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y9705_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y9705_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-22; SER-24; SER-28;SER-33; SER-139 AND SER-140, AND MASS SPECTROMETRY.	18327897 [Abstract]
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND SER-140, AND MASSSPECTROMETRY.	17372656 [Abstract]